PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0146s00220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 365aa    MW: 40494.4 Da    PI: 7.8999
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0146s00220.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-4073150178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +C v+gC +dls+++eyhrrh+vCe+hsk+pvvlv g++qrfCqqCsrfh+l efDe krsCr+rL++hn+rrrk+q+
  Vradi0146s00220.1  73 CCSVDGCISDLSDCREYHRRHRVCEKHSKTPVVLVGGKQQRFCQQCSRFHSLGEFDEVKRSCRKRLDGHNRRRRKPQP 150
                        6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3267135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.72771148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-3872153IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3074147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDWDGKEFAW DPRGLELANG EGQRNEAASV DLRLGEEKSL PDVAKDPRES KTVSSPSGSS  60
KRSRLQNGSQ NMCCSVDGCI SDLSDCREYH RRHRVCEKHS KTPVVLVGGK QQRFCQQCSR  120
FHSLGEFDEV KRSCRKRLDG HNRRRRKPQP PSLFMAAEKF MYNYKGPRIL HFGSPETYVN  180
PIMRSMWSAT AKTGAESGYD PPRLLYRIDK HKQDKGHPLW QENDPIVANA NGAILGAPIC  240
QPIHGTITPS TGGGKSSRKH SSDAKPGSFD SGCALYLLST LQSQSPESSM VQSSITCPMQ  300
SPSGSVHFDT VNEYAYSETE KDKPSGQVLV LDNTTNLHYN GMLQMGLDGL VENDDPLTLP  360
FLWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-27741471184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130147KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523826.10.0PREDICTED: teosinte glume architecture 1-like
TrEMBLA0A0S3RW050.0A0A0S3RW05_PHAAN; Uncharacterized protein
STRINGGLYMA19G26390.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100312640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-42SBP family protein